Our health essays are perfect for students who are studying health related courses. Whether you’re doing your degree or studying for a health related course at college, use our student-donated health resources to help you prepare your own work.
In the American health system, the profession of nursing holds a special place. It is the largest health care profession globally where millions of professional nurses work in diverse settings and fields. While most nurses work in hospitals, their knowledge and skills extend well beyond the walls. Working independently and with other health care professionals … Read more
The Ontario health care system is among one of the best medical centers in the world. Residents who qualify for this health system have the privilege to access various kinds of health care facilities in their community. In Ontario, citizens are given a medical health cover insurance that will cater for their medical needs during … Read more
Background This prevalence study for Molar incisor hypomineralisation (MIH) is a rare data in the literature, as this was undertaken in Salem, a fluorosis endemic district in Tamilnadu. Aim To evaluate the prevalence of MIH among school children residing in the district of Salem, a fluorosis endemic region. Design A target sample of 5000 children … Read more
The pituitary gland is a central endocrine organ that regulates basic physiological functions incuding growth, reproduction and metabolic homeostasis. It situates at the base of the brain, under the optic chiasm, inside a depression on the upper surface of the sphenoid bone, the sella turcica. The pituitary gland consists of two major parts, the adenohypophysis … Read more
STATEMENT OF THE PROBLEM For many African American women, using a hair relaxer is an essential tool to maintaining their hair. However, the chemicals used in relaxers are being linked to causing health issues that can be chronic or deadly. According to the American Journal of Epidemiology, women can be exposed to the chemicals in … Read more
Obesity is a local, national, and international problem. Over the past 25 years obesity rates in England have increased by more than 50% and being overweight has become accepted as a norm for adults, with estimates that by 2050 half the population will be obese (Foresight, 2007). As a society the UK is less active … Read more
The given work, directed towards the identification of vaccine candidates for Atherosclerosis caused by the factors of Periodontitis and this has resulted in the prediction of some acceptable epitopes that can be used to elicit immune response against both Atherosclerosis and Periodontitis. WDAPNGTPNPNPNPNPNPNPGTTTLSESFENGIPASWKTIDADGDGHGWKPGNAPGIAGYNSNGCV, LDDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEITVAVSET and SNLYSANFEYLIPANADPVVITQNIIVTGQGEVVIPGGVYDYCITN are recognised as B-cell epitopes. These epitope stretches contain … Read more
This was the beginning of the therapeutic relationship as we engaged in a conversation where he explained he was feeling scared about going to operation theatre the next day. I didn’t dismiss his feelings and concerns, yet I assured him that he was in the best hands and would be taken care of. I discussed … Read more
The history of swine flu dates back to investigation of the 1981 Spanish influenza Pandemic, which infected one third of the words population (an estimated 500 million people) and caused approximately 50 million deaths. Swine flu is an acute and highly contagious respiratory disease caused by various which became a pandemic globally. It started as … Read more
Obsessive Compulsive Disorder, also known as OCD, is one of the world’s most widespread and potentially harmful diseases out there. According to statistics from the World Global Health Organization, “OCD is ranked ten among all diseases as a cause for disability.” (Charlotte-anxiety-and-depression-treatment.com) Obsessive Compulsive Disorder is an anxiety disorder characterized by wild, undesirable thoughts and … Read more
HIV has several tricks it uses to avoid being neutralized by antibodies. After it was discovered in 1984 that AIDS was caused by HIV, a major obstacle for making a proper vaccine for the global pandemic had emerged. It was found that HIV reproduces at a very high speed, hastily copying its genetic code each … Read more
According to World Health Organisation (WHO) ‘mental health is defined as a state of well-being in which every individual realize his or her own potential, can cope with the normal stresses of life, can work productively and fruitfully, and is able to make a contribution to her or his community’ (World Health Organization 2014). What … Read more
Diabetic nephropathy is the primary basis of kidney disease in patients initiating renal replacement therapy and affects ‘40% of type 1 and type 2 diabetic patients(Jorge et al. 2005). In accordance to current WHO status there are around 347 million people globally having diabetes. In 2012 diabetes was the undeviating reason for 1.5 million deaths. … Read more
The diabetes was first time described by Asian Egyptian by all most 3000 years ago. The term was first coined by Araetus of Cappodocia in 81-133AD. Later on in the history Thomas Wills added the word mellitus (honey sweet) in 1675 after rediscovering the sweetness of blood and urine. Similarly 1776 Dobson first confirmed the … Read more
Introduction: Skin diseases relating to travel are common and there are different types of microbial agents and vectors which may lead to infections. Knowing the type of infections in different geographical regions may help to prevent the appearance of infection. Vaccines, repellents, bed nets and clothes are recommended for preventing the infections. Purpose: The main … Read more
